Domain name
Domains list :   0-9, a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t, u, v, w, x, y, z

Domains listing letter F  -  page 1104

1.   firstcricketportal.com
2.   firstcrime.com
3.   firstcriteria.com
4.   firstcriterion.com
5.   firstcriticalillness.com
6.   firstcritique.com
7.   firstcrm.com
8.   firstcr.net
9.   firstcro.com
10.   first-croisieres.com
11.   firstcrop.com
12.   first-crop-marketing.com
13.   firstcrop.net
14.   firstcrops.com
15.   firstcrops.net
16.   first-croquet-great-info.info
17.   firstcrossbordercommercialinsurance.com
18.   firstcross.com
19.   firstcrosscountry.com
20.   first-cross-country-running-great-info.info
21.   first-cross-country-skiing-great-info.info
22.   firstcrossing.com
23.   firstcrossing.net
24.   firstcrossing.org
25.   firstcrossvilletitle.com
26.   firstcrosville.com
27.   firstcrow.com
28.   firstcrown.com
29.   firstcrownmedical.com
30.   firstcrownmortgageinc.com
31.   firstcrown.net
32.   firstcrownrealty.com
33.   firstcrp.com
34.   firstcrp.net
35.   firstcrp.org
36.   firstcruacao.com
37.   firstcru.com
38.   firstcrude.com
39.   firstcruisebestcruise.com
40.   firstcruiseclub.com
41.   first-cruise.com
42.   firstcruise.com
43.   firstcruiseessentials.com
44.   firstcruise.info
45.   firstcruises.com
46.   first-cruises.info
47.   firstcruisetips.com
48.   firstcru.net
49.   firstcru.org
50.   firstcrusade.com
51.   firstcrusaders.com
52.   first-crush.com
53.   firstcrush.com
54.   firstcrushcottage.com
55.   firstcrush.net
56.   firstcrushonline.com
57.   firstcrush.org
58.   firstcrushparty.com
59.   firstcrushperfume.com
60.   firstcrushproductions.com
61.   firstcrushusa.com
62.   firstcrushwinebar.com
63.   firstcrushwine.com
64.   firstcrushwines.com
65.   first-cry.com
66.   firstcry.com
67.   first-cry.net
68.   firstcryonicintradimentionalfellowship.com
69.   firstcrystalclearrealty.com
70.   firstcrystalmortgage.com
71.   firstcrystalmortgage.net
72.   firstcrystals.com
73.   firstcsa.com
74.   firstcsb.com
75.   first-cs.com
76.   firstcsi.com
77.   firstcs.net
78.   firstcss.com
79.   firstcstr.com
80.   firstctb.com
81.   firstctcapital.com
82.   firstctcav.com
83.   firstctcav.net
84.   firstct.com
85.   firstctfinancial.com
86.   firstcthome.com
87.   firstctizens.com
88.   firstctizensonline.com
89.   firstctmortgage.com
90.   firstct.net
91.   firstctoflondon.com
92.   firstctsale.com
93.   firstcts.com
94.   firstcu1.org
95.   firstcuarcao.com
96.   first-cuba.com
97.   firstcuba.com
98.   first-cuban-cigars.com
99.   firstcube.com
100.   firstcube.org
101.   firstcu.biz
102.   first-cu.com
103.   firstcu.com
104.   firstcu-coop.com
105.   firstcucoop.com
106.   firstcu-coop.net
107.   firstcucoop.net
108.   firstcu-coop.org
109.   firstcucoop.org
110.   firstcucraco.com
111.   firstcue.com
112.   first-cu.info
113.   firstcu.info
114.   firstcuisine.com
115.   firstcullmannazarene.org
116.   firstcultural.com
117.   firstculture.com
118.   firstcultures.com
119.   firstcumbath.com
120.   firstcumbaths.com
121.   firstcumberland.com
122.   firstcumberlandmortgage.com
123.   firstcumberlandmtg.com
124.   firstcumberland.net
125.   first-cumberland.org
126.   firstcumberland.org
127.   firstcumberlandpresbyterian.org
128.   firstcum.com
129.   firstcumfacial.com
130.   firstcummers.com
131.   firstcums.com
132.   firstcumshot.com
133.   firstcumshots.com
134.   firstcumswallow.com
135.   firstcumswallowing.com
136.   firstcumswap.com
137.   firstcumswapping.com
138.   firstcumvids.com
139.   firstcun.com
140.   firstcu.net
141.   firstcunet.com
142.   firstcun.net
143.   firstcunnilingus.com
144.   firstcun.org
145.   firstcunow.com
146.   firstcuonline.com
147.   firstcuonline.net
148.   firstcuonline.org
149.   firstcu.org
150.   firstcup101.com
151.   firstcupbar.com
152.   firstcup.biz
153.   firstcupbrew.com
154.   firstcupcafe.com
155.   firstcup-coffee.com
156.   firstcupcoffee.com
157.   firstcupcoffeeservice.com
158.   first-cup.com
159.   firstcup.com
160.   firstcupid.com
161.   firstcupidity.com
162.   firstcupmarketing.com
163.   firstcup-md.com
164.   firstcup.net
165.   firstcupofcoffee.com
166.   firstcupoftampabay.com
167.   firstcupoftampabay.net
168.   firstcup-pdx.com
169.   firstcup.us
170.   firstcuracaobank.com
171.   firstcuracaocigar.com
172.   firstcuracao.com
173.   firstcuracao.info
174.   firstcuracaointernationalbank.com
175.   firstcuracao.net
176.   firstcuracao.org
177.   firstcuracao-support.com
178.   firstcuracau.com
179.   firstcuraccao.com
180.   firstcuracoa.com
181.   firstcuraco.com
182.   firstcurcaco.com
183.   firstcurcao.com
184.   firstcure.com
185.   firstcuremesothelioma.net
186.   firstcure.net
187.   firstcureonline.com
188.   firstcures.com
189.   first-curling-great-info.info
190.   firstcurocao.com
191.   firstcurrencies.com
192.   first-currency-best-information.info
193.   firstcurrencychoice.biz
194.   firstcurrencychoice.com
195.   firstcurrencychoice.info
196.   firstcurrency.com
197.   firstcurrency.info
198.   firstcurrent.com
199.   first-curriculum-online.info
200.   firstcurry.com
201.   firstcurscao.com
202.   firstcursco.com
203.   firstcurtaincall.com
204.   firstcurtain.com
205.   firstcurucao.com
206.   firstcurves.com
207.   firstcurvology.com
208.   firstcus.com
209.   firstcu-secure.com
210.   firstcustodian.com
211.   firstcustodiannigeria.com
212.   first-custom-best-information.info
213.   firstcustomboat.com
214.   firstcustom.com
215.   firstcustomer.com
216.   first-customer.net
217.   firstcustomer.net
218.   first-customer.org
219.   firstcustomer.org
220.   firstcustommortgage.com
221.   firstcustom-online-printing.com
222.   firstcustoms.com
223.   firstcut4kids.com
224.   firstcutawards.com
225.   firstcut.biz
226.   firstcutbooks.com
227.   first-cut.com
228.   firstcut.com
229.   firstcutdemos.com
230.   firstcutdemos.net
231.   firstcute.com
232.   firstcutentertainment.com
233.   firstcutfilm.com
234.   firstcutfilms.com
235.   firstcutgolf.com
236.   firstcutgrass.com
237.   firstcutinc.com
238.   firstcut.info
239.   firstcutisthedeepest.com
240.   firstcutlawncare.com
241.   firstcutlervillecrc.org
242.   firstcutlery.com
243.   firstcutlive.com
244.   firstcutmedia.com
245.   firstcutmusic.com
246.   firstcutmusicproductions.com
247.   first-cut.net
248.   firstcut.net
249.   firstcut.org
250.   firstcutperformancehorses.com
251.   firstcutpictures.com
252.   firstcutproduce.com
253.   firstcutproductions.com
254.   firstcutproto.com
255.   firstcutprototype.com
256.   firstcutprototypes.com
257.   firstcutrecords.com
258.   firstcutrestoration.com
259.   firstcuts.com
260.   firstcutstudios.com
261.   firstcutstudios.org
262.   firstcutsystem.com
263.   firstcut.us
264.   firstcutvinyl.com
265.   firstcuupdate.com
266.   first-cu.us
267.   firstcu.us
268.   firstcu-wi.com
269.   first-cv.com
270.   firstcv.com
271.   first-cv.org
272.   firstcx.com
273.   firstcyberbankandloan.com
274.   firstcyberbank.com
275.   firstcybercash.com
276.   firstcyberchurch.com
277.   firstcybercity.com
278.   firstcyber.com
279.   firstcybercontact.com
280.   firstcyberfederal.com
281.   firstcyberfinance.com
282.   firstcyberfinancial.com
283.   firstcyberkitchen.com
284.   firstcyberkrewe.com
285.   firstcyberkrewe.net
286.   firstcybermall.com
287.   firstcybernational.com
288.   firstcyber.net
289.   firstcyberschool.com
290.   firstcybersecurity.com
291.   firstcybersecurity.info
292.   firstcybersecurity.net
293.   firstcybersecurity.org
294.   firstcyberserv.com
295.   firstcyberservicesinc.com
296.   firstcybershop.com
297.   firstcyberstop.com
298.   firstcybertelco.com
299.   firstcyberwar.com
300.   firstcyberworld.com
301.   firstcycle.com
302.   firstcycle.org
303.   firstcycler.net
304.   firstcycles.com
305.   firstcyclesports.com
306.   firstcycleworks.com
307.   firstcycling.com
308.   first-cycling-great-info.info
309.   first-cycling.info
310.   first-cycling-online.info
311.   firstcylinder.com
312.   firstcymru.com
313.   firstcyprus.com
314.   firstcyracao.com
315.   firstcyrus.com
316.   first-cyte.com
317.   firstcyte.com
318.   firstd8.com
319.   firstdabmed.com
320.   firstdad.com
321.   firstdaddieslesson.com
322.   firstdaddieslessons.com
323.   firstdaddy.com
324.   firstdaddylesons.com
325.   firstdaddylesson.com
326.   firstdaddylessons.com
327.   firstdaddyslesons.com
328.   firstdaddyslession.com
329.   firstdaddyslessn.com
330.   firstdaddyslesson.com
331.   firstdaddyslesson.info
332.   firstdaddyslessons.com
333.   firstdade.com
334.   firstdademortgage.biz
335.   firstdademortgage.com
336.   firstdademortgage.info
337.   firstdademortgage.net
338.   firstdadiesdollar.com
339.   firstdadsbank.com
340.   firstdadsex.com
341.   firstdadslessons.com
342.   firstdadv.com
343.   firstdadylesson.com
344.   firstdadylessons.com
345.   firstdadyslesson.com
346.   firstdaily.com
347.   firstdailydeals.com
348.   firstdairy.com
349.   firstdaisy.com
350.   first-daito-ryu-great-info.info
351.   firstdakotabank.com
352.   firstdakota.com
353.   firstdakotaenterprises.com
354.   firstdakotanationalbank.com
355.   firstdakota.net
356.   firstdakota.org
357.   firstdakotatitle.com
358.   firstdakota.us
359.   firstdale.com
360.   firstdalingstore.com
361.   firstdallas.com
362.   firstdallas.info
363.   firstdallas.net
364.   firstdallas.org
365.   firstdallassingles.com
366.   firstdanceathome.com
367.   firstdanceatl.com
368.   firstdancechicago.com
369.   first-dance.com
370.   firstdance.com
371.   firstdancecompany.biz
372.   firstdancecompany.com
373.   firstdancecompany.info
374.   firstdancecompany.net
375.   firstdancecompany.org
376.   firstdanceconfidence.com
377.   firstdancedance.com
378.   firstdancedc.com
379.   firstdancedj.com
380.   firstdancedvd.com
381.   firstdanceent.com
382.   firstdanceexpressions.com
383.   firstdancefilms.com
384.   firstdanceimpression.com
385.   first-dance-impressions.com
386.   firstdanceimpressions.com
387.   firstdanceinstruction.com
388.   firstdancelesson.com
389.   firstdancelessons.com
390.   firstdancelyrics.com
391.   firstdancemoves.com
392.   firstdancemoves.net
393.   firstdancemusic.com
394.   firstdancemusiclist.com
395.   first-dance.net
396.   firstdance.net
397.   firstdancenyc.com
398.   firstdanceny.com
399.   firstdanceorangecounty.com
400.   first-dance.org
401.   firstdance.org
402.   firstdancephotography.com
403.   firstdanceplaque.com
404.   firstdanceproductionsatlanta.com
405.   firstdanceproductions.com
406.   firstdanceproductions.net
407.   firstdancer.com
408.   firstdancesbygreg.com
409.   firstdances.com
410.   firstdancesong.com
411.   firstdancesonglist.com
412.   firstdancesonglyrics.com
413.   firstdancesongs.com
414.   firstdancesongwords.com
415.   firstdancespecialists.com
416.   firstdancestudio.com
417.   firstdancestudios.com
418.   firstdancetips.com
419.   firstdancetogether.com
420.   firstdancetulsa.com
421.   firstdanceuk.com
422.   firstdance.us
423.   firstdancevideo.com
424.   firstdancevideos.com
425.   firstdancevideo.us
426.   first-dance-wedding-song.com
427.   firstdanceweddingsong.com
428.   first-dance-wedding-songs.com
429.   firstdanceweddingsongs.com
430.   firstdanceweddingsongs.info
431.   firstdancewords.com
432.   firstdan.com
433.   firstdaneinspace.com
434.   firstdaneproducts.com
435.   firstdanvillebank.com
436.   firstdarajobs.com
437.   firstdare.com
438.   firstdarkride.com
439.   firstdarrylpetitt.com
440.   firstdart.com
441.   firstdartmouth.com
442.   firstdartmouthhomes.com
443.   firstdart.net
444.   first-darts-great-info.info
445.   firstdash.com
446.   firstdashes.com
447.   firstdataagent.com
448.   firstdataagentoffice.com
449.   firstdataagents.com
450.   firstdataapiintegration.com
451.   firstdataapplication.com
452.   firstdata-applications.com
453.   firstdataapplications.com
454.   firstdataapprovals.com
455.   firstdataatm.com
456.   firstdataatm.net
457.   firstdata-autogroup.com
458.   firstdataautogroup.com
459.   firstdatabank.com
460.   firstdatabankiddf.com
461.   firstdatabankiddf.info
462.   firstdatabankiddf.us
463.   firstdatabank.info
464.   firstdatabanknddf.com
465.   firstdatabanknddf.info
466.   firstdatabanknddfplus.info
467.   firstdatabanknddf.us
468.   firstdatabank.net
469.   firstdatabanknutritionistpro.info
470.   firstdatabankqmr.com
471.   firstdatabankqmr.us
472.   firstdatabank.us
473.   first-database.com
474.   firstdatabase.com
475.   firstdatabase.net
476.   firstdatabiometricmerchantservices.com
477.   firstdatabiometricprocessing.com
478.   firstdatabiometrics.com
479.   firstdatabiometricterminals.com
480.   firstdata.biz
481.   firstdatabrandcenter.com
482.   first-databuilders.com
483.   firstdatabusiness.com
484.   firstdatabusinessservices.com
485.   firstdatacable.com
486.   firstdataca.com
487.   firstdatacalifornia.com
488.   firstdatacard.com
489.   firstdatacardissuing.com
490.   firstdatacardservice.com
491.   firstdatacardservices.com
492.   firstdatacardservices.net
493.   firstdatacareer.com
494.   firstdatacareeres.com
495.   firstdatacareers.com
496.   firstdatacareres.com
497.   firstdatacart.com
498.   firstdatachicago.com
499.   firstdatachildcare.com
500.   firstdatachildcareservices.com
501.   firstdatachina.com
502.   firstdatacleints.com
503.   firstdataclientadvisory.com
504.   firstdataclientadvisorycouncil.com
505.   firstdataclients.com
506.   first-data.com
507.   firstdata.com
508.   firstdatacommercialcard.com
509.   firstdatacommercial.com
510.   firstdataconferences.com
511.   firstdatacontactlesscard.com
512.   firstdatacontactlesscardmerchants.com
513.   firstdatacontactlesscardmerchantservices.com
514.   firstdatacontactlesscardprocessing.com
515.   firstdatacorp.biz
516.   first-data-corp.com
517.   first-datacorp.com
518.   firstdatacorp.com
519.   firstdatacorpevents.com
520.   firstdatacorp.info
521.   firstdatacorp.net
522.   firstdatacorporateperks.com
523.   firstdatacorporateservices.com
524.   firstdatacorporation.biz
525.   first-data-corporation.com
526.   firstdatacorporation.com
527.   firstdatacorporation.info
528.   firstdatacorporationinternational.biz
529.   firstdatacorporationinternational.com
530.   firstdatacorporationinternational.info
531.   firstdatacorporationinternational.net
532.   firstdatacorporationinternational.org
533.   firstdatacorporation.net
534.   firstdatacorporation.org
535.   firstdatacorp.org
536.   firstdatacorpsales.com
537.   firstdatacorp.us
538.   firstdatacraftservices.com
539.   firstdatacreditcard.com
540.   firstdatacreditcardprocessing.com
541.   firstdatacreditcards.com
542.   firstdatacreditcardservice.com
543.   firstdatacva.com
544.   firstdatadebit.com
545.   firstdatadirect.com
546.   firstdatadirectsales.com
547.   firstdataecommerce.com
548.   firstdataencompass.com
549.   firstdataencompass.net
550.   firstdataenergy.com
551.   firstdataeps.com
552.   firstdataeurope.com
553.   firstdataeval.com
554.   firstdataevents.com
555.   firstdata-fdfs.biz
556.   firstdatafinancial.biz
557.   firstdatafinancialservices.biz
558.   firstdatafinancialservices.com
559.   firstdatafinsvc.biz
560.   firstdatafis.com
561.   firstdatafleetservices.com
562.   firstdataflorida.com
563.   firstdatafoundation.com
564.   firstdatafoundation.org
565.   firstdatafranchiseprocessingservices.com
566.   firstdatafs.biz
567.   firstdataga.com
568.   firstdatagiftcard.com
569.   firstdatagiftcards.com
570.   firstdatagloballeasing.com
571.   firstdatagovernmentsolutions.com
572.   firstdatagroup.com
573.   firstdata-h24.com
574.   firstdatahc.com
575.   firstdatahealthcare.com
576.   firstdatahealthcareservice.com
577.   firstdatahealthcareservices.com
578.   firstdatahealth.com
579.   firstdatahealthservices.com
580.   firstdataiberica.com
581.   firstdataiberica.net
582.   firstdata-iip.com
583.   firstdataillinois.com
584.   firstdata-inc.com
585.   firstdatainc.com
586.   firstdataindependantsalesofwyoming.com
587.   firstdataindependentsalesca.com
588.   first-data-independent-sales.com
589.   firstdataindependentsales.com
590.   firstdataindependentsales.info
591.   firstdataindependentsales.net
592.   firstdataindependentsalesofwyoming.com
593.   firstdataindependentsalesonline.com
594.   firstdataindependentsalesservices.com
595.   firstdata.info
596.   firstdatainfo.com
597.   firstdataintegratedsalessupport.com
598.   firstdataintegratedsalessupport.net
599.   firstdatainternational.com
600.   firstdatainternet.com
601.   firstdatainternetprocessing.com
602.   firstdataissarizona.com
603.   firstdataisschicago.com
604.   firstdataisschicago.net
605.   firstdata-iss.com
606.   firstdataiss.com
607.   firstdataiss.net
608.   firstdataisswindycity.com
609.   firstdataisswindycity.net
610.   firstdatajob.com
611.   firstdatajobs.com
612.   firstdatajp.com
613.   firstdatakeyedmerchantservices.com
614.   firstdatakorea.com
615.   firstdatakorea.net
616.   firstdatalajolla.com
617.   firstdataleasing.com
618.   firstdataleasingsolution.com
619.   firstdataleasingsolutions.com
620.   firstdatalink.com
621.   firstdatalinks.com
622.   firstdata-losangeles.com
623.   first-datamanagement.com
624.   firstdatamanagement.com
625.   firstdatamarketing.com
626.   firstdatamedia.com
627.   first-data-merchant-account.com
628.   firstdatamerchantaccount.com
629.   firstdatamerchantaccount.net
630.   firstdata-merchantaccounts.com
631.   firstdatamerchant-accounts.com
632.   firstdatamerchantaccounts.com
633.   firstdatamerchantaccounts.net
634.   first-data-merchant.com
635.   firstdatamerchant.com
636.   firstdatamerchants.com
637.   firstdatamerchantservice.com
638.   firstdatamerchantservices.biz
639.   first-data-merchant-services.com
640.   firstdatamerchantservices.com
641.   firstdatamerchantservices.info
642.   firstdatamerchantservices.net
643.   firstdatamerchantservices.org
644.   firstdatamidwest.com
645.   firstdata-minnesota.com
646.   firstdataminnesota.com
647.   firstdata-mn.com
648.   firstdatamn.com
649.   firstdatamobile.com
650.   firstdatamobile.net
651.   firstdatamobile.org
652.   firstdatamobilesolutions.com
653.   firstdatamobilesolutions.net
654.   firstdatamobilesolutions.org
655.   firstdatamotomerchantservices.com
656.   firstdatanbms.com
657.   first-data.net
658.   firstdata.net
659.   firstdatanet.com
660.   firstdatanet.net
661.   firstdatanet.org
662.   firstdatanetwork.com
663.   firstdatanetworks.com
664.   firstdatanewyork.com
665.   firstdatanorth.com
666.   firstdatanow.com
667.   firstdatany.com
668.   firstdataofmiami.com
669.   firstdataofnorthamerica.com
670.   firstdataonline.com
671.   firstdataonlineservices.com
672.   firstdataonlinetransactionservices.com
673.   firstdata.org
674.   firstdatapartner.com
675.   firstdatapartners.com
676.   firstdatapaymentsolutions.com
677.   firstdatapeer.com
678.   firstdataperks.com
679.   firstdatapetroleum.com
680.   firstdatapoker.com
681.   firstdatapoker.net
682.   firstdatapos.com
683.   firstdatapr.com
684.   firstdataprepaidadvisorycouncil.com
685.   firstdataprepaidservices.com
686.   firstdataprocessing.com
687.   firstdataprocessing.net
688.   firstdataprocessingservices.com
689.   firstdatarecovery.com
690.   firstdata-recovery.info
691.   first-data-recovery-site-h.info
692.   first-data-recovery-site-i.info
693.   first-data-recovery-site-j.info
694.   first-data-recovery-site-k.info
695.   firstdatareferrals.com
696.   firstdataremitco.com
697.   firstdataresource.com
698.   firstdataresources.biz
699.   firstdataresources.com
700.   firstdataresources.info
701.   firstdatarestaurantservice.com
702.   firstdatarestaurantservices.com
703.   firstdataretailatmservices.com
704.   firstdataretailatmservices.net
705.   firstdataretailcard.com
706.   firstdataretail.com
707.   first-dataroom.com
708.   firstdatasa.com
709.   firstdata-sales.com
710.   firstdatasales.com
711.   firstdatasales.net
712.   firstdatasalesservicearizona.com
713.   firstdatasalesservice.com
714.   firstdatasalesservicemaricopa.com
715.   firstdatasalesservicesouthwest.com
716.   firstdatasalesserviceusa.com
717.   firstdatasecure.com
718.   firstdatasecurity.com
719.   firstdatasecurity.net
720.   firstdatasecurity.org
721.   firstdataserver.net
722.   firstdataservices.com
723.   firstdataservices.net
724.   firstdatashoppingcart.com
725.   firstdatasiliconvalley.com
726.   firstdatasmallbusinessservices.com
727.   firstdatasolutions.com
728.   firstdatasource.com
729.   firstdatasource.net
730.   firstdatasouth.com
731.   firstdatastoredvalue.com
732.   firstdatastorefrontservices.com
733.   firstdataswipedmerchantservices.com
734.   firstdatasystem.com
735.   firstdatasystems.com
736.   firstdatasystems.net
737.   firstdatatdc.com
738.   firstdatatexas.com
739.   firstdata-today.com
740.   firstdata-tokyo.com
741.   firstdatatransactionprocessing.com
742.   firstdatatransactionprocessingservices.com
743.   firstdatatransportationservices.com
744.   firstdatatravelservices.com
745.   firstdata.us
746.   firstdata-usa.com
747.   firstdatausa.com
748.   firstdatautilities.com
749.   firstdatautility.com
750.   firstdatavault.com
751.   firstdatavault.net
752.   firstdatavermont.com
753.   firstdatavoiceservices.com
754.   firstdatavt.com
755.   firstdatawallet.com
756.   firstdataweb.com
757.   firstdatawesternunion.com
758.   firstdatawesternunionfoundation.org
759.   firstdatawesternunion.org
760.   firstdatawestflorida.com
761.   firstdatawholesale.com
762.   firstdatawindycity.com
763.   firstdatawireless.com
764.   firstdataworld.com
765.   firstdataworldwide.com
766.   firstdat.com
767.   firstdatcorp.com
768.   firstdate360.com
769.   firstdate360.info
770.   firstdateadventures.com
771.   firstdateadvice.com
772.   firstdateadvices.com
773.   firstdateangel.com
774.   firstdateangels.com
775.   firstdatebackgroundcheck.com
776.   firstdatebags.com
777.   firstdatebang.com
778.   firstdatebangers.com
779.   first-date.biz
780.   firstdate.biz
781.   firstdateblink182.info
782.   firstdateblog.com
783.   firstdateblowjob.com
784.   firstdateblowjobs.com
785.   firstdateboobiepincher.com
786.   firstdatecafe.com
787.   firstdatecelebrities.com
788.   firstdatecheck.com
789.   firstdatechicago.com
790.   firstdatechick.com
791.   firstdateclub.com
792.   firstdatecoach.com
793.   firstdatecoaches.com
794.   firstdatecoaching.com
795.   firstdatecolorado.com
796.   first-date.com
797.   firstdate.com
798.   firstdatecompany.com
799.   firstdateconversation.com
800.   firstdateconversations.com
801.   firstdatecouple.com
802.   firstdatecouples.com
803.   firstdatecoupling.com
804.   firstdatedc.com
805.   firstdatedesignshow.com
806.   firstdatedevil.com
807.   firstdatedevils.com
808.   firstdatediaries.com
809.   firstdatediaries.net
810.   firstdatedinner.com
811.   firstdatedirect.com
812.   firstdateetiquette.com
813.   firstdateetiquettes.com
814.   firstdateexperience.com
815.   firstdatefacials.com
816.   firstdatefashions.com
817.   firstdatefilms.com
818.   first-date-flat.com
819.   firstdateflowers.com
820.   firstdateforher.com
821.   firstdateforhim.com
822.   firstdateforthem.com
823.   firstdateforyou.com
824.   firstdatefuck.com
825.   firstdatefuckers.com
826.   firstdatefucking.com
827.   firstdatefucks.com
828.   firstdatefux.com
829.   firstdategame.biz
830.   firstdategame.com
831.   firstdategame.info
832.   firstdategame.net
833.   firstdategame.org
834.   firstdategram.com
835.   firstdateguide.com
836.   firstdatehints.com
837.   firstdatehookups.com
838.   firstdatehumor.com
839.   firstdateidea.com
840.   firstdateideas.com
841.   firstdate.info
842.   firstdateinfo.com
843.   firstdatejoke.com
844.   firstdatejokes.com
845.   firstdatekindofmovie.net
846.   firstdatekiss.com
847.   firstdatekit.com
848.   firstdatelady.org
849.   firstdatelegends.com
850.   firstdateline.com
851.   firstdatelounge.com
852.   firstdatelove.com
853.   firstdatelove.net
854.   firstdatemagic.com
855.   firstdatemaker.com
856.   firstdatemedia.com
857.   firstdatemovie.com
858.   firstdatemovies.com
859.   firstdatemusic.com
860.   first-date.net
861.   firstdate.net
862.   first-datentechnik.com
863.   first-datentechnik.net
864.   firstdateoftherestofyourlife.com
865.   firstdateonline.com
866.   firstdate.org
867.   firstdateplan.com
868.   firstdateplay.com
869.   firstdateporn.com
870.   firstdateproductions.com
871.   firstdatepros.com
872.   firstdatequestion.com
873.   firstdatequestions.com
874.   firstdatequestions.info
875.   firstdater.com
876.   firstdaters.com
877.   firstdateru.com
878.   firstdaterules.com
879.   firstdates.biz
880.   first-dates.com
881.   firstdates.com
882.   firstdatesecrets.com
883.   firstdatesecretsrevealed.com
884.   firstdatesex.com
885.   firstdateshortfilm.com
886.   firstdateshow.com
887.   firstdateshows.com
888.   firstdates.info
889.   firstdatesingles.com
890.   firstdatesite.com
891.   first-dates.net
892.   firstdates.net
893.   firstdatesonline.com
894.   firstdates.org
895.   firstdatespotoftheyear.com
896.   firstdatestars.com
897.   firstdatestories.com
898.   firstdatesuggestions.com
899.   firstdatesunlimited.com
900.   firstdatesurvival.com
901.   firstdates.us
902.   firstdateteen.com
903.   firstdatetip.com
904.   first-date-tips.com
905.   firstdatetips.com
906.   firstdatetips.info
907.   first-date-tips.net
908.   firstdatetips.org
909.   firstdatetshirts.com
910.   firstdateupdate.com
911.   firstdate.us
912.   firstdateware.com
913.   firstdatewithbob.com
914.   firstdatingadvice.com
915.   firstdatingaid.com
916.   first-dating-best-information.info
917.   first-dating.com
918.   firstdating.com
919.   firstdatingdate.com
920.   firstdating.info
921.   first-dating.net
922.   firstdating.net
923.   firstdatingnow.com
924.   firstdatingonline.com
925.   first-dating-online.info
926.   first-dating-service.com
927.   firstdatingsite.com
928.   firstdatjobs.com
929.   firstdatse.com
930.   first-daughter.com
931.   firstdaughter.com
932.   firstdaughterdvd.com
933.   firstdaughtermediaworks.com
934.   firstdaughtermovie.com
935.   firstdaughtermovie.net
936.   firstdaughter.org
937.   firstdaughters.com
938.   firstdaughtersoundtrack.com
939.   firstdaughterthemovie.com
940.   firstdaughtervideo.com
941.   firstdaugthermovie.com
942.   firstdavincianchurch.com
943.   firstdavincicode.info
944.   firstdaviscorp.com
945.   firstdavisrealty.com
946.   firstdawg.com
947.   firstdawn.com
948.   firstdawn.net
949.   firstdawnprinting.com
950.   firstdawood.com
951.   firstdawoodislamic.com
952.   firstdayaction.com
953.   firstdayactivities.com
954.   firstdayart.com
955.   firstdayatschool.com
956.   firstdayattheoffice.com
957.   firstday.biz
958.   firstdayblack.com
959.   firstdaybooks.com
960.   firstdayburn.com
961.   firstdaycards.com
962.   firstdaycatalog.com
963.   first-day.com
964.   firstday.com
965.   firstdaycottage.com
966.   firstdaycottages.com
967.   firstdaycover.biz
968.   firstdaycover.com
969.   firstdaycover.info
970.   firstdaycover.net
971.   firstdaycovers.biz
972.   first--day--covers.com
973.   first-day-covers.com
974.   firstdaycovers.com
975.   firstdaycoversgalore.com
976.   firstdaycovers.info
977.   firstdaycovers.net
978.   firstdaycoversonline.com
979.   firstdaycovers.org
980.   firstdaycoversource.com
981.   firstdaycoverstore.com
982.   firstdaycover.us
983.   firstdaycreation.com
984.   firstdaycs.com
985.   firstdaydead.com
986.   firstdaydelivery.com
987.   firstdaydentalplan.com
988.   firstdayedition.com
989.   firstdayeternal.com
990.   firstdayexpress.com
991.   firstdayfiancial.com
992.   firstdayfinancial.biz
993.   firstdayfinancial.com
994.   firstdayfinancial.info
995.   firstdayfinancial.net
996.   firstdayfinancial.org
997.   firstdayfinancial.us
998.   firstdayfiniancial.com
999.   firstdayfirstshow.com
1000.   firstdayforward.org
Homepage - Privacy - Terms - Contact - Domains list
whoisentry.com @